LL-37 — 5mg
LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans. This 37-amino acid peptide is a key component of innate immune defense research and is studied for its membrane-disrupting properties. Supplied as lyophilized powder with HPLC verification.
Specifications
| Purity | >97% |
| Quantity | 5mg |
| Form | Lyophilized Powder |
| Molecular Weight | 4493.37 g/mol |
| CAS Number | 154947-66-7 |
| Sequence | [LL-37, 37 aa] |
| Storage | Store at -20°C. Avoid repeated freeze-thaw cycles. |
Storage & Handling:
- Storage (Lyophilized): Store at -20°C in a dry, desiccated environment.
- After Reconstitution: Store reconstituted peptide at 2–8°C and use within 30 days. For long-term storage, aliquot and freeze at -20°C. Avoid repeated freeze-thaw cycles.
- Reconstitution: Reconstitute in sterile bacteriostatic water or appropriate buffer depending on experimental needs.
⚠️ Research Use Only. Not for Human or Veterinary Use.
LL-37 5mg is provided strictly for laboratory research use. This compound is not intended for human consumption or therapeutic application. We work directly with qualified manufacturers to ensure high standards of purity and consistency. High-performance liquid chromatography (HPLC) testing is performed on select production batches. Intended for use by qualified researchers and laboratory professionals.
📦 Typically ships within 1-2 working days